DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TDX

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_188415.2 Gene:TDX / 821056 AraportID:AT3G17880 Length:380 Species:Arabidopsis thaliana


Alignment Length:107 Identity:36/107 - (33%)
Similarity:66/107 - (61%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYPVRNKDDLDQQLILAE--DKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENE 64
            |..:.:..:|:.:...|:  .:|:::.|.|.|||||:.::|....||.|:| |||.|||::|:..
plant   272 VISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RVVFLKVDIDKAN 335

  Fly    65 DITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHA 106
            |:...:|::|:|||.||:.|..::..||.:...|.:.:.:|:
plant   336 DVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 33/93 (35%)
TDXNP_188415.2 Hip_N 6..44 CDD:271228
TPR <108..267 CDD:440225
TPR repeat 112..140 CDD:276809
TPR repeat 145..175 CDD:276809
TPR repeat 180..206 CDD:276809
TRX_family 292..374 CDD:239245 32/82 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.