DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TDX

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_188415.2 Gene:TDX / 821056 AraportID:AT3G17880 Length:380 Species:Arabidopsis thaliana


Alignment Length:107 Identity:36/107 - (33%)
Similarity:66/107 - (61%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYPVRNKDDLDQQLILAE--DKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENE 64
            |..:.:..:|:.:...|:  .:|:::.|.|.|||||:.::|....||.|:| |||.|||::|:..
plant   272 VISIHSTSELEAKTKAAKKASRLLILYFTATWCGPCRYMSPLYSNLATQHS-RVVFLKVDIDKAN 335

  Fly    65 DITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHA 106
            |:...:|::|:|||.||:.|..::..||.:...|.:.:.:|:
plant   336 DVAASWNISSVPTFCFIRDGKEVDKVVGADKGSLEQKIAQHS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 33/93 (35%)
TDXNP_188415.2 Hip_N 6..44 CDD:271228
TPR repeat 112..140 CDD:276809
PLN03088 117..>213 CDD:215568
TPR repeat 145..175 CDD:276809
TPR repeat 180..206 CDD:276809
PRK14552 <200..256 CDD:237753
TRX_family 292..374 CDD:239245 32/82 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.