DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TTL2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001319556.1 Gene:TTL2 / 820724 AraportID:AT3G14950 Length:730 Species:Arabidopsis thaliana


Alignment Length:85 Identity:22/85 - (25%)
Similarity:39/85 - (45%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGGNVLE 88
            |:.|:......||.|:..:|.|..:|.. :..|||.:.:..::.....|..:|||...|.|..::
plant   648 VVHFFRASDPQCKEISTFVDALCVRYPS-LHFLKVEIVKCPEVGNAERVRVVPTFKIYKLGIRMK 711

  Fly    89 LFVGCNSDKLAKLMEKHAGV 108
            ..| |.|.:..:...:|.|:
plant   712 EIV-CPSKEALEKTVRHYGL 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 20/81 (25%)
TTL2NP_001319556.1 TPR repeat 258..286 CDD:276809
LapB 274..593 CDD:442196
TPR repeat 291..321 CDD:276809
TPR repeat 402..430 CDD:276809
TPR repeat 529..559 CDD:276809
TPR repeat 564..588 CDD:276809
TRX_family 635..725 CDD:239245 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.