DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and TH9

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001078124.1 Gene:TH9 / 820018 AraportID:AT3G08710 Length:140 Species:Arabidopsis thaliana


Alignment Length:101 Identity:39/101 - (38%)
Similarity:62/101 - (61%) Gaps:3/101 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYPVRNKDDLDQQLILA--EDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENE 64
            |:.:..|:..|.:|..|  :.|:||.:|.|.|||||||:||...||::::|. ::.|.|:|||..
plant    25 VHLITTKESWDDKLAEADRDGKIVVANFSATWCGPCKIVAPFFIELSEKHSS-LMFLLVDVDELS 88

  Fly    65 DITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAK 100
            |.:..:::.:.|||.|:|.|..:...||.|..:|.|
plant    89 DFSSSWDIKATPTFFFLKNGQQIGKLVGANKPELQK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 36/90 (40%)
TH9NP_001078124.1 TRX_family 32..126 CDD:239245 37/94 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm998
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.