DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and NTRC

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_565954.1 Gene:NTRC / 818766 AraportID:AT2G41680 Length:529 Species:Arabidopsis thaliana


Alignment Length:77 Identity:16/77 - (20%)
Similarity:41/77 - (53%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGGN 85
            :::::.:.:..||||:.:.|.|:::..:|:..|..::::::|:::|.....:...|...|.|...
plant   443 RVILVLYTSPTCGPCRTLKPILNKVVDEYNHDVHFVEIDIEEDQEIAEAAGIMGTPCVQFFKNKE 507

  Fly    86 VLELFVGCNSDK 97
            :|....|....|
plant   508 MLRTISGVKMKK 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 16/77 (21%)
NTRCNP_565954.1 TRX_reduct 86..391 CDD:273540
TRX_NTR 430..526 CDD:239247 16/77 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.