DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txn2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_445783.1 Gene:Txn2 / 79462 RGDID:71040 Length:166 Species:Rattus norvegicus


Alignment Length:106 Identity:39/106 - (36%)
Similarity:73/106 - (68%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDIT 67
            :.|::..|...:::.:|.. ||:||:|.|||||||:.|:|:::..:...:||:.||::|::.|:.
  Rat    62 FNVQDGPDFQDRVVNSETP-VVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLA 125

  Fly    68 VEYNVNSMPTFVFIKGGNVLELFVGC-NSDKLAKLMEKHAG 107
            :||.|:::||.:.||.|:|::.|||. :.|:|...::|..|
  Rat   126 IEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAFLKKLIG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 35/92 (38%)
Txn2NP_445783.1 TRX_family 72..162 CDD:239245 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.