DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Pdia5

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_082571.1 Gene:Pdia5 / 72599 MGIID:1919849 Length:517 Species:Mus musculus


Alignment Length:77 Identity:28/77 - (36%)
Similarity:42/77 - (54%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNV--DENEDITVEYNVNSM 75
            ::|:..|:|.:::.|||.||..||.|.|...:.|.|....:|:..:||  .|.|:|..||||...
Mouse   161 RRLLKREEKPLLMMFYAPWCSMCKRIMPHFQKAATQVRGHIVLAGMNVYPSEFENIKEEYNVRGY 225

  Fly    76 PTFVFIKGGNVL 87
            ||..:.:.|..|
Mouse   226 PTICYFEKGRFL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 28/77 (36%)
Pdia5NP_082571.1 PDI_b_PDIR_N 26..137 CDD:239365
PTZ00102 122..517 CDD:240266 28/77 (36%)
PDI_a_PDIR 150..254 CDD:239295 28/77 (36%)
PDI_a_PDIR 275..377 CDD:239295
PDI_a_PDIR 396..499 CDD:239295
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 514..517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.