DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Pdia6

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_082235.2 Gene:Pdia6 / 71853 MGIID:1919103 Length:440 Species:Mus musculus


Alignment Length:133 Identity:34/133 - (25%)
Similarity:67/133 - (50%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDLDQQLILAEDKLVVIDFYADWCGPCKIIAPK----LDELAQQYSDRVVVLKVNVDENEDITVE 69
            |..|:.::.:|| :.:::|||.|||.||.:.|:    ..|:.:|...:|.:..|:...|:.:...
Mouse   168 DTFDKNVLDSED-VWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASR 231

  Fly    70 YNVNSMPTF-VFIKGGNVLELFVG-CNSDKLAKLMEKHAGVYTDEAADVKAVHIDGECIVDLTAE 132
            |.:...||. :|.||.:.::...| ..||.:::.::    :::|.|...:.:.|..|.|...|.|
Mouse   232 YGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALD----LFSDNAPPPELLEIINEDIAKKTCE 292

  Fly   133 SSE 135
            ..:
Mouse   293 EHQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 25/97 (26%)
Pdia6NP_082235.2 PDI_a_P5 26..128 CDD:239299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..161
PDI_a_P5 161..266 CDD:239299 27/98 (28%)
P5_C 275..404 CDD:239281 5/21 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..440
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 437..440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.