DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and txn2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001008161.1 Gene:txn2 / 493523 XenbaseID:XB-GENE-943373 Length:170 Species:Xenopus tropicalis


Alignment Length:108 Identity:40/108 - (37%)
Similarity:76/108 - (70%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            :.:.|::.||. |:.::..:..||:||:|.|||||||:||:|:::..:...:||:.||::|::.|
 Frog    63 VTFNVQDADDF-QERVVGSETPVVVDFHAQWCGPCKILAPRLEKVVAKQQGKVVMAKVDIDDHTD 126

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGC-NSDKLAKLMEKHAG 107
            :.:|:.|:::||.:.||.|:|::.|||. :.|:|...::|..|
 Frog   127 LALEFEVSAVPTVLAIKNGDVVDKFVGLKDEDQLDAFLKKLIG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 35/92 (38%)
txn2NP_001008161.1 Thioredoxin_like 69..168 CDD:381987 38/99 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.