DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and CG3719

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_651990.1 Gene:CG3719 / 44736 FlyBaseID:FBgn0024986 Length:160 Species:Drosophila melanogaster


Alignment Length:101 Identity:28/101 - (27%)
Similarity:64/101 - (63%) Gaps:3/101 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVE 69
            :::..:.||: ::..|..|:::|:|:||.||||:.||:.||.:. |:.:.:..::|:.|.|:...
  Fly    53 IKDHYEFDQK-VINSDNPVIVNFHAEWCDPCKILTPKMLELLEN-SNEIDLAVIDVETNLDLVET 115

  Fly    70 YNVNSMPTFVFIKGGNVLELFVG-CNSDKLAKLMEK 104
            :.|.::|..:..:.|.|::.|:| .:::.:..|::|
  Fly   116 FEVKAVPAVLAFRNGVVVDKFIGLVDANSIETLIDK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 27/93 (29%)
CG3719NP_651990.1 TRX_family 58..150 CDD:239245 27/93 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.