DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and pdia8

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001003517.1 Gene:pdia8 / 445123 ZFINID:ZDB-GENE-040801-20 Length:493 Species:Danio rerio


Alignment Length:99 Identity:32/99 - (32%)
Similarity:48/99 - (48%) Gaps:1/99 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNS 74
            |.|...:..|.:.:::.|||.|||.||.:||:.:..|.:....|.:.||:...|.:|...|.||.
Zfish    32 DADFDYLAPEHETLLVKFYAPWCGHCKKLAPEFESAASRLKGTVTLAKVDCTANTEICKHYGVNG 96

  Fly    75 MPTFVFIKGGNVLELFVGCNS-DKLAKLMEKHAG 107
            .||....:.|.....:.|..| |.:...|:|.||
Zfish    97 YPTLKIFRNGQESSSYDGPRSADGIVDYMKKQAG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 27/92 (29%)
pdia8NP_001003517.1 ER_PDI_fam 25..484 CDD:273457 32/99 (32%)
pdi_dom 30..129 CDD:273454 30/96 (31%)
PDI_b_ERp57 132..236 CDD:239367
PDI_b'_ERp72_ERp57 240..353 CDD:239371
PDI_a_PDI_a'_C 373..476 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.