DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and p4hb

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001034820.1 Gene:p4hb / 395048 XenbaseID:XB-GENE-494070 Length:506 Species:Xenopus tropicalis


Alignment Length:160 Identity:46/160 - (28%)
Similarity:74/160 - (46%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDLD------------QQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSD--RVVVLKVN 59
            ||.|            ::::..|:|.|.::|||.|||.||.:||..|:|.::|.|  .:::.|::
 Frog   362 DDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKYKDHENIIIAKMD 426

  Fly    60 VDENEDITVEYNVNSMPTFVFIKGG---NVLELFVGCNSDKLAKLMEKHAGVYTDEAADVKAVHI 121
            ...||...|:  ::|.||..|...|   ||.:.......:..:|.:|...   .|.|||      
 Frog   427 STANEIEAVK--IHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGG---QDGAAD------ 480

  Fly   122 DGECIVDLTAESSESDNDNNNVNEVSAHDE 151
              |.:.|| .::.|||.:..  :|....||
 Frog   481 --EDLEDL-EDADESDLEEG--DEAHTKDE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 30/96 (31%)
p4hbNP_001034820.1 ER_PDI_fam 25..474 CDD:273457 33/113 (29%)
pdi_dom 29..133 CDD:273454
PDI_b_family 137..232 CDD:239279
PDI_b'_family 244..347 CDD:239280
PDI_a_PDI_a'_C 368..470 CDD:239293 29/103 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.