DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and pdia2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001307463.1 Gene:pdia2 / 394023 ZFINID:ZDB-GENE-040426-705 Length:555 Species:Danio rerio


Alignment Length:137 Identity:43/137 - (31%)
Similarity:69/137 - (50%) Gaps:14/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LAEDKLVVIDFYADWCGPCKIIAPKLDELAQQY---SDRVVVLKVNVDENEDITVEYNVNSMPTF 78
            |:|:|.::::|||.|||.|:.:.|...|:|.|.   |..|.:.||:..|.:::..|::|:|.||.
Zfish    70 LSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVDSFPTL 134

  Fly    79 VFIKGGN--VLELFVGCNSDK-LAKLMEKHAGVYTDEAADVKAVHI---DGECIV-----DLTAE 132
            .|.|.||  ....|.|..:.| :.:.:|||.........|||:...   ..|.:|     ||..|
Zfish   135 KFFKEGNRQNATTFFGKRTLKGIKRWLEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLEGE 199

  Fly   133 SSESDND 139
            .:::..|
Zfish   200 KAKTFYD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 32/93 (34%)
pdia2NP_001307463.1 ER_PDI_fam 56..512 CDD:273457 43/137 (31%)
PDI_a_family 65..161 CDD:239259 31/90 (34%)
PDI_b_family 169..268 CDD:239279 9/38 (24%)
PDI_b'_family 280..382 CDD:239280
PDI_a_PDI_a'_C 403..505 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.