DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txl

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster


Alignment Length:153 Identity:43/153 - (28%)
Similarity:77/153 - (50%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVE 69
            :.::.....:|..|..:|||:||.|.||||||.|||..:....:| .:.:.|||:||:.:|....
  Fly     6 INDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKY-PKAIFLKVDVDKCQDTAAG 69

  Fly    70 YNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAGVYTDEAADVKAVHIDGECIVDLTAESS 134
            ..|::||||:|.:....::...|.:.:.|...:::|.|....|......    |:.:::|....|
  Fly    70 QGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGEDY----GQGLMELNTFIS 130

  Fly   135 ESDNDNNNVNEVSAHDENAVLEH 157
            :.:.:  .:||...|:    |:|
  Fly   131 KQECE--CLNEADDHN----LKH 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 32/91 (35%)
TxlNP_523938.2 TRX_family 10..103 CDD:239245 32/93 (34%)
PITH 125..266 CDD:283785 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146939at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.