DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txl

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster


Alignment Length:153 Identity:43/153 - (28%)
Similarity:77/153 - (50%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVE 69
            :.::.....:|..|..:|||:||.|.||||||.|||..:....:| .:.:.|||:||:.:|....
  Fly     6 INDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKY-PKAIFLKVDVDKCQDTAAG 69

  Fly    70 YNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAGVYTDEAADVKAVHIDGECIVDLTAESS 134
            ..|::||||:|.:....::...|.:.:.|...:::|.|....|......    |:.:::|....|
  Fly    70 QGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQEHIGTSGGEEGGEDY----GQGLMELNTFIS 130

  Fly   135 ESDNDNNNVNEVSAHDENAVLEH 157
            :.:.:  .:||...|:    |:|
  Fly   131 KQECE--CLNEADDHN----LKH 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 32/91 (35%)
TxlNP_523938.2 TRX_family 10..103 CDD:239245 32/93 (34%)
PITH 125..266 CDD:461848 7/29 (24%)

Return to query results.
Submit another query.