DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txndc8

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001004092.1 Gene:Txndc8 / 362525 RGDID:1303121 Length:127 Species:Rattus norvegicus


Alignment Length:126 Identity:34/126 - (26%)
Similarity:64/126 - (50%) Gaps:23/126 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            ||..:::..:..:.|..|.::|||::|.|.||||||:|||....::.||.: |:..:|:||.:::
  Rat     1 MVQKIKSMREFKELLGAAGNRLVVVEFSAQWCGPCKMIAPAFQAMSLQYRN-VMFAQVDVDSSQE 64

  Fly    66 ITVEYNVNSMPTFVFIK----------------------GGNVLELFVGCNSDKLAKLMEK 104
            :|...::..:|||...|                      |...:..|.|.:.:||.:.:::
  Rat    65 LTEHCSIQVVPTFQMFKHSRKVTPFSRLKRILCCFRSGPGSKKIFEFQGADIEKLEEKIQE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 32/114 (28%)
Txndc8NP_001004092.1 Thioredoxin_like 1..89 CDD:412351 29/88 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.