DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and NME9

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_016861795.1 Gene:NME9 / 347736 HGNCID:21343 Length:353 Species:Homo sapiens


Alignment Length:147 Identity:36/147 - (24%)
Similarity:59/147 - (40%) Gaps:35/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVD---------ENEDITVEYN 71
            :|:...|.|:|.|..||||||.:.....::.         ::|.:|         :..|:..:|.
Human    35 MLSSKGLTVVDVYQGWCGPCKPVVSLFQKMR---------IEVGLDLLHFALAEADRLDVLEKYR 90

  Fly    72 VNSMPTFVFIKGGNVLELFVGCNSDKLAKLM------EKHAGVYTDEAADVK--AVHIDGECIVD 128
            ....|||:|..||.::.:..|.|:..|.|.:      ||.......|...:|  |:..:.||:  
Human    91 GKCEPTFLFYAGGELVAVVRGANAPLLQKTILDQLEAEKKVLAEGRERKVIKDEALSDEDECV-- 153

  Fly   129 LTAESSESDNDNNNVNE 145
                   |...||..:|
Human   154 -------SHGKNNGEDE 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 26/103 (25%)
NME9XP_016861795.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.