DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Pdia3

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_059015.2 Gene:Pdia3 / 29468 RGDID:68430 Length:510 Species:Rattus norvegicus


Alignment Length:96 Identity:34/96 - (35%)
Similarity:48/96 - (50%) Gaps:18/96 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYS--DRVVVLKVNVDENEDITVEYN 71
            ||    ::.||||.|:|:|||.|||.||.:.||..||.::.|  ..:|:.|::...| |:...|.
  Rat   392 DD----IVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYE 451

  Fly    72 VNSMPTFVF-----------IKGGNVLELFV 91
            |...||..|           .:||..|..|:
  Rat   452 VKGFPTIYFSPANKKLTPKKYEGGRELNDFI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 32/92 (35%)
Pdia3NP_059015.2 ER_PDI_fam 31..492 CDD:273457 34/96 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..510
Prevents secretion from ER 507..510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.