DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and trx2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_595954.2 Gene:trx2 / 2539898 PomBaseID:SPBC12D12.07C Length:133 Species:Schizosaccharomyces pombe


Alignment Length:94 Identity:35/94 - (37%)
Similarity:57/94 - (60%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMP 76
            |....::.||:.|:|||||||||||.:.|.|::|::| :.:...:.||.|:..||..:..|.::|
pombe    39 DYNTRISADKVTVVDFYADWCGPCKYLKPFLEKLSEQ-NQKASFIAVNADKFSDIAQKNGVYALP 102

  Fly    77 TFVFIKGGNVLELFVGCNSDKLAKLMEKH 105
            |.|..:.|..|:..||.:...|:.|:.|:
pombe   103 TMVLFRKGQELDRIVGADVKTLSSLLAKY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 34/92 (37%)
trx2NP_595954.2 TRX_family 39..122 CDD:239245 32/83 (39%)

Return to query results.
Submit another query.