DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and trx2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_595954.2 Gene:trx2 / 2539898 PomBaseID:SPBC12D12.07c Length:133 Species:Schizosaccharomyces pombe


Alignment Length:94 Identity:35/94 - (37%)
Similarity:57/94 - (60%) Gaps:1/94 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEYNVNSMP 76
            |....::.||:.|:|||||||||||.:.|.|::|::| :.:...:.||.|:..||..:..|.::|
pombe    39 DYNTRISADKVTVVDFYADWCGPCKYLKPFLEKLSEQ-NQKASFIAVNADKFSDIAQKNGVYALP 102

  Fly    77 TFVFIKGGNVLELFVGCNSDKLAKLMEKH 105
            |.|..:.|..|:..||.:...|:.|:.|:
pombe   103 TMVLFRKGQELDRIVGADVKTLSSLLAKY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 33/91 (36%)
trx2NP_595954.2 TRX_family 39..122 CDD:239245 32/83 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.