DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txn1

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_035790.1 Gene:Txn1 / 22166 MGIID:98874 Length:105 Species:Mus musculus


Alignment Length:106 Identity:45/106 - (42%)
Similarity:64/106 - (60%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            ||..:.:|:...:.|..|.|||||:||.|.||||||:|.|....|..:||: ||.|:|:||:.:|
Mouse     1 MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSN-VVFLEVDVDDCQD 64

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHA 106
            :..:..|..||||.|.|.|..:..|.|.|.:||...:.::|
Mouse    65 VAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 41/91 (45%)
Txn1NP_035790.1 Thioredoxin 4..103 CDD:365862 42/99 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4965
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 1 1.010 - - QHG54229
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.