DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txn1

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_035790.1 Gene:Txn1 / 22166 MGIID:98874 Length:105 Species:Mus musculus


Alignment Length:106 Identity:45/106 - (42%)
Similarity:64/106 - (60%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            ||..:.:|:...:.|..|.|||||:||.|.||||||:|.|....|..:||: ||.|:|:||:.:|
Mouse     1 MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSN-VVFLEVDVDDCQD 64

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHA 106
            :..:..|..||||.|.|.|..:..|.|.|.:||...:.::|
Mouse    65 VAADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEASITEYA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 41/91 (45%)
Txn1NP_035790.1 Thioredoxin 2..103 CDD:395038 43/101 (43%)

Return to query results.
Submit another query.