DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txndc2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001139474.1 Gene:Txndc2 / 213272 MGIID:2389312 Length:550 Species:Mus musculus


Alignment Length:100 Identity:31/100 - (31%)
Similarity:58/100 - (57%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            :|..:::|::.::.|..|.:|||.:||.|.|||||:::.|....|:.::.| |:.|:|:.::.|.
Mouse   446 LVRVIKDKEEFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLSLKHED-VIFLEVDTEDCEQ 509

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAK 100
            :..:..:..:|||.|.|....:..|.|....||.:
Mouse   510 LVQDCEIFHLPTFQFYKNEEKVGEFSGALVGKLER 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 29/87 (33%)
Txndc2NP_001139474.1 TRX_family 454..546 CDD:239245 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.