DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Txndc2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001139474.1 Gene:Txndc2 / 213272 MGIID:2389312 Length:550 Species:Mus musculus


Alignment Length:100 Identity:31/100 - (31%)
Similarity:58/100 - (57%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            :|..:::|::.::.|..|.:|||.:||.|.|||||:::.|....|:.::.| |:.|:|:.::.|.
Mouse   446 LVRVIKDKEEFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLSLKHED-VIFLEVDTEDCEQ 509

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAK 100
            :..:..:..:|||.|.|....:..|.|....||.:
Mouse   510 LVQDCEIFHLPTFQFYKNEEKVGEFSGALVGKLER 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 29/86 (34%)
Txndc2NP_001139474.1 PTZ00449 <126..395 CDD:185628
TRX_family 454..546 CDD:239245 29/91 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.