DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and trx-4

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_491142.1 Gene:trx-4 / 189905 WormBaseID:WBGene00021548 Length:107 Species:Caenorhabditis elegans


Alignment Length:98 Identity:41/98 - (41%)
Similarity:66/98 - (67%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KDDLDQQLILAEDKL--VVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEY 70
            |||.:.:.|.||.|.  |::.|.|.|||||::|.|:::|||.::.||:.:||::|||.:.:..||
 Worm     6 KDDDEFKTIFAEKKTQPVILFFTASWCGPCQMIKPRVEELAAEHKDRLSILKIDVDECDGVGEEY 70

  Fly    71 NVNSMPTFVFIKGGNVLELFVGCNSDKLAKLME 103
            .:||||||:.|..|...:.|.|.|:.|..::::
 Worm    71 EINSMPTFLLIVDGIKKDQFSGANNTKFEEMVK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 38/93 (41%)
trx-4NP_491142.1 TRX_family 9..103 CDD:239245 38/93 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157677
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm14658
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.