DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and trx-4

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_491142.1 Gene:trx-4 / 189905 WormBaseID:WBGene00021548 Length:107 Species:Caenorhabditis elegans


Alignment Length:98 Identity:41/98 - (41%)
Similarity:66/98 - (67%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KDDLDQQLILAEDKL--VVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDITVEY 70
            |||.:.:.|.||.|.  |::.|.|.|||||::|.|:::|||.::.||:.:||::|||.:.:..||
 Worm     6 KDDDEFKTIFAEKKTQPVILFFTASWCGPCQMIKPRVEELAAEHKDRLSILKIDVDECDGVGEEY 70

  Fly    71 NVNSMPTFVFIKGGNVLELFVGCNSDKLAKLME 103
            .:||||||:.|..|...:.|.|.|:.|..::::
 Worm    71 EINSMPTFLLIVDGIKKDQFSGANNTKFEEMVK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 38/92 (41%)
trx-4NP_491142.1 CnoX 7..106 CDD:442352 40/97 (41%)

Return to query results.
Submit another query.