DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and trx-3

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_500578.2 Gene:trx-3 / 187389 WormBaseID:WBGene00019717 Length:158 Species:Caenorhabditis elegans


Alignment Length:145 Identity:35/145 - (24%)
Similarity:56/145 - (38%) Gaps:54/145 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKD----DLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSD-----RVVVL---- 56
            :|.||    |..:.|   :.|:||:.|.|.|||||:...|.:.||.||.:.     .|::|    
 Worm    11 LRLKDGTMVDAGEHL---KGKIVVLYFSASWCGPCRQFTPIMKELYQQIAATNQPIEVILLSRDY 72

  Fly    57 -KVNVDEN------------------EDITVEYNVNSMPTFVFIKGGNVLELFVGC--------- 93
             :..:||.                  |....:|:|.::|:.      .|::.|..|         
 Worm    73 MRFQLDEYYESHGCSWGVVPLRDPIIEKCLEKYDVKALPSC------RVVDEFGNCIDANARQSV 131

  Fly    94 ----NSDKLAKLMEK 104
                ...|:|:|..|
 Worm   132 EFYREKYKMAELFNK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 31/133 (23%)
trx-3NP_500578.2 TryX_like_family 11..132 CDD:239262 31/129 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.