DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and trx-2

DIOPT Version :10

Sequence 1:NP_572212.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001256207.1 Gene:trx-2 / 179434 WormBaseID:WBGene00007099 Length:145 Species:Caenorhabditis elegans


Alignment Length:96 Identity:28/96 - (29%)
Similarity:57/96 - (59%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDI 66
            |:.:.:.:|..:::|.:... |::||:|:|||||:.:.|:|:|........|::.|:|||...::
 Worm    39 VFDIDSVEDFTEKVIQSSVP-VIVDFHAEWCGPCQALGPRLEEKVNGRQGSVLLAKINVDHAGEL 102

  Fly    67 TVEYNVNSMPTFVFIKGGNVLELFVGCNSDK 97
            .::|.::::||....|.|..:..|.|...|:
 Worm   103 AMDYGISAVPTVFAFKNGEKISGFSGVLDDE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_572212.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 14..106 CDD:469754 26/84 (31%)
trx-2NP_001256207.1 CnoX 38..143 CDD:442352 28/96 (29%)

Return to query results.
Submit another query.