DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Y55F3AR.2

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_500036.2 Gene:Y55F3AR.2 / 176929 WormBaseID:WBGene00021933 Length:254 Species:Caenorhabditis elegans


Alignment Length:139 Identity:47/139 - (33%)
Similarity:62/139 - (44%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDI 66
            |..|....|.|::......|.|.:||.|.|||||:.|||...:||.||... |.|||:|||....
 Worm     3 VIVVNGDSDFDRKFSAGNGKAVFVDFTASWCGPCQYIAPIFSDLANQYKGS-VFLKVDVDECRGT 66

  Fly    67 TVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAGVYTDEAADVKAVHIDGECIVDLTA 131
            ...|.||:||||:....|.......|.:...|..::.|:|.  |..|.......:.|.     |.
 Worm    67 AATYGVNAMPTFIAFVNGQKKATIQGADESGLRSMVAKYAS--TSAAWSGTGQRLSGS-----TT 124

  Fly   132 ESSESDNDN 140
            .||.|.:.:
 Worm   125 GSSSSTSSS 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 34/91 (37%)
Y55F3AR.2NP_500036.2 TRX_family 10..103 CDD:239245 36/93 (39%)
DUF4605 157..212 CDD:373801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157681
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.