DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and Y49E10.4

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_499613.1 Gene:Y49E10.4 / 176664 WormBaseID:WBGene00013030 Length:436 Species:Caenorhabditis elegans


Alignment Length:145 Identity:32/145 - (22%)
Similarity:61/145 - (42%) Gaps:18/145 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RNKDDLDQQLILAE---DKLV-------VIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNV 60
            :..|...:.::|.:   ||||       :::|:|.|||.|:.:.|:..:.|::...||....::.
 Worm   148 KKSDKKGKVVVLTDSNFDKLVLNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEMGGRVKFGALDA 212

  Fly    61 DENEDITVEYNVNSMPTFVFIKGG-----NVLELFVGCNSDKLAKLMEKHAGVYTDEAADVKAVH 120
            ..:|.|..::.:...||..|...|     :..:...|..|..|....|..   |.|..|..:.|.
 Worm   213 TAHESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQGGRTSTDLISYAESK---YDDFGAAPEVVE 274

  Fly   121 IDGECIVDLTAESSE 135
            ..|:.:|:...:..:
 Worm   275 GTGKAVVETVCKDKQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 25/106 (24%)
Y49E10.4NP_499613.1 PDI_a_P5 26..127 CDD:239299
PDI_a_P5 156..259 CDD:239299 24/102 (24%)
P5_C 269..405 CDD:239281 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.