DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and ZK973.11

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_491361.1 Gene:ZK973.11 / 172039 WormBaseID:WBGene00022836 Length:447 Species:Caenorhabditis elegans


Alignment Length:136 Identity:31/136 - (22%)
Similarity:62/136 - (45%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDR---VVVLKVNVDENED 65
            |....|..|:.|.:.::.:..::|||.||..||.:.|..|::....||.   :.|.|::......
 Worm    27 PTAVLDLSDKFLDVKDEGMWFVEFYAPWCAHCKRLHPVWDQVGHTLSDSNLPIRVGKLDCTRFPA 91

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKHAGVYTDEAADVKAVHIDGECIVDLT 130
            :..:.::...||.:|.:.|:|::...|...:.|....::.|      |..::.::.:....|.|:
 Worm    92 VANKLSIQGYPTILFFRNGHVIDYRGGREKEALVSFAKRCA------APIIEVINENQIEKVKLS 150

  Fly   131 AESSES 136
            |.|..|
 Worm   151 ARSQPS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 21/94 (22%)
ZK973.11NP_491361.1 ER_PDI_fam 29..>348 CDD:273457 30/134 (22%)
PDI_a_TMX3 29..132 CDD:239298 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.