DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment TrxT and PDIA5

DIOPT Version :9

Sequence 1:	NP_001284881.1	Gene:	TrxT / 31443	FlyBaseID:	FBgn0029752	Length:	157	Species:	Drosophila melanogaster
Sequence 2:	NP_006801.1	Gene:	PDIA5 / 10954	HGNCID:	24811	Length:	519	Species:	Homo sapiens

Alignment Length:	77	Identity:	27/77 - (35%)
Similarity:	41/77 - (53%)	Gaps:	2/77 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 QQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNV--DENEDITVEYNVNSM 75
            ::|:..|:|.::|.|||.||..||.:.|...:.|.|.....|:..:||  .|.|:|..||:|...
Human   163 RRLLKKEEKPLLIMFYAPWCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGF 227

  Fly    76 PTFVFIKGGNVL 87
            ||..:.:.|..|
Human   228 PTICYFEKGRFL 239

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
TrxT	NP_001284881.1	Thioredoxin	13..105	CDD:278513	27/77 (35%)
PDIA5	NP_006801.1	PDI_b_PDIR_N	28..139	CDD:239365
		PDI_a_PDIR	152..256	CDD:239295	27/77 (35%)
		PTZ00102	168..512	CDD:240266	26/72 (36%)
		PDI_a_PDIR	277..379	CDD:239295
		PDI_a_PDIR	398..501	CDD:239295
		Prevents secretion from ER. /evidence=ECO:0000255\|PROSITE-ProRule:PRU10138	516..519
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910