DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and PDIA6

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001269633.1 Gene:PDIA6 / 10130 HGNCID:30168 Length:492 Species:Homo sapiens


Alignment Length:133 Identity:34/133 - (25%)
Similarity:67/133 - (50%) Gaps:11/133 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DDLDQQLILAEDKLVVIDFYADWCGPCKIIAPK----LDELAQQYSDRVVVLKVNVDENEDITVE 69
            |..|:.::.:|| :.:::|||.|||.||.:.|:    ..|:.:|...:|.:..|:...|:.:...
Human   220 DSFDKNVLDSED-VWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASR 283

  Fly    70 YNVNSMPTF-VFIKGGNVLELFVG-CNSDKLAKLMEKHAGVYTDEAADVKAVHIDGECIVDLTAE 132
            |.:...||. :|.||.:.::...| ..||.:::.::    :::|.|...:.:.|..|.|...|.|
Human   284 YGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALD----LFSDNAPPPELLEIINEDIAKRTCE 344

  Fly   133 SSE 135
            ..:
Human   345 EHQ 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 25/97 (26%)
PDIA6NP_001269633.1 PDI_a_P5 78..180 CDD:239299
PDI_a_P5 213..318 CDD:239299 27/98 (28%)
P5_C 327..456 CDD:239281 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.