DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and XB5961763

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001123676.1 Gene:XB5961763 / 100170428 XenbaseID:XB-GENE-5961764 Length:104 Species:Xenopus tropicalis


Alignment Length:104 Identity:31/104 - (29%)
Similarity:59/104 - (56%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65
            |:..:|:.::|...|..|..|||:::|.:..||.|.|:||:.::|..:|.| :::.|| :|:...
 Frog     1 MIRYLRSVEELQYALRDAGQKLVLVNFSSHKCGQCTIVAPEYEKLCTEYPD-ILLYKV-LDDAPK 63

  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEK 104
            :.....:.|.|||:|.|....::.|.|.:..:|.:.:.|
 Frog    64 LCQHCEITSTPTFLFYKDRLKIKQFSGADIVQLRETIRK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 28/92 (30%)
XB5961763NP_001123676.1 TRX_family 9..100 CDD:239245 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4850
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.