DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TrxT and XB5909790

DIOPT Version :9

Sequence 1:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001123670.1 Gene:XB5909790 / 100170420 XenbaseID:XB-GENE-5909791 Length:105 Species:Xenopus tropicalis


Alignment Length:103 Identity:47/103 - (45%)
Similarity:66/103 - (64%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VRNKDDLDQ-QLILAE--DKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENEDI 66
            ||:.:.||: |.||.|  |||||:||.|.||||||:|:|..::|:.:..| ||.:||:||:.:|:
 Frog     2 VRHVESLDEFQNILKEAGDKLVVVDFTATWCGPCKMISPVFEKLSVENPD-VVFIKVDVDDAQDV 65

  Fly    67 TVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEK 104
            ....:|..||||.|.|.|..:..|.|.|.   |.|::|
 Frog    66 AAHCDVKCMPTFHFYKNGQKVHEFSGANQ---ASLIQK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 43/95 (45%)
XB5909790NP_001123670.1 TRX_family 9..100 CDD:239245 43/94 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4850
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm9465
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.