DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and AT1G06960

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_850936.1 Gene:AT1G06960 / 837206 AraportID:AT1G06960 Length:229 Species:Arabidopsis thaliana


Alignment Length:229 Identity:121/229 - (52%)
Similarity:162/229 - (70%) Gaps:24/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTM 69
            |||:|||.::||||||||||:|||.:|||||::||:|||||.|:||||:|:|.|:.:||||:|.|
plant     8 PNQSIYIKHINEKIKKEELKRSLYCLFSQFGRLLDVVALKTPKLRGQAWVVFTEVTAASNAVRQM 72

  Fly    70 QGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKK---------KPS 125
            |.||||||||:|.|:||.||.|.|.:|:|..:.||:|       .:||.::|:         .|:
plant    73 QNFPFYDKPMRIQYAKSKSDYVTKAEGSFVPKEKKMK-------QEEKVERKRHAEETQQPSMPN 130

  Fly   126 SAENSN--------PNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAF 182
            .|...|        |:.|...|||.|||:.|||.|||.|||.:||.|:|||||:|::..:..|||
plant   131 GATTQNGMPVPPFQPSGQDTMPPNNILFIHNLPIETNSMMLQLLFEQYPGFKEIRMIEAKPGIAF 195

  Fly   183 VEFTTELQSNAAKEALQGFKITPTHAMKITFAKK 216
            ||:..::||:.|.:|||||||||.:.|.::||||
plant   196 VEYEDDVQSSMAMQALQGFKITPQNPMVVSFAKK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 99/188 (53%)
RRM_SF 6..96 CDD:302621 61/89 (69%)
RRM2_SNF 137..216 CDD:240923 44/78 (56%)
AT1G06960NP_850936.1 RRM1_U1A_like 12..88 CDD:409692 53/75 (71%)
RRM2_U1A_like 153..225 CDD:409693 41/71 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 111 1.000 Domainoid score I2079
eggNOG 1 0.900 - - E1_KOG4206
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I1103
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm2910
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - O PTHR10501
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.