DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and U2B''

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_180585.1 Gene:U2B'' / 817576 AraportID:AT2G30260 Length:232 Species:Arabidopsis thaliana


Alignment Length:232 Identity:117/232 - (50%)
Similarity:158/232 - (68%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTM 69
            |||:|||.||||:|||||||:|||.:|||||:|||:|||||.|:||||:|.|.|:.:|.:|:|.|
plant     8 PNQSIYIQNLNERIKKEELKRSLYCLFSQFGRILDVVALKTPKLRGQAWVTFSEVTAAGHAVRQM 72

  Fly    70 QGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENS---- 130
            |.||||||||::.|:|:.||.:||.:|||..:.||.|       .:||.::|::.|...|:    
plant    73 QNFPFYDKPMRLQYAKAKSDCLAKAEGTFVPKDKKRK-------QEEKVERKREDSQRPNTANGP 130

  Fly   131 ----------------NPNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHD 179
                            .|:.|...|||.|||:.|||.||..|||.:||.|:|||||:|::..:..
plant   131 SANGPSANNGVPAPSFQPSGQETMPPNNILFIQNLPHETTSMMLQLLFEQYPGFKEIRMIDAKPG 195

  Fly   180 IAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK 216
            |||||:..::|::.|.:.||||||||.:.|.|:||||
plant   196 IAFVEYEDDVQASIAMQPLQGFKITPQNPMVISFAKK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 96/191 (50%)
RRM_SF 6..96 CDD:302621 59/89 (66%)
RRM2_SNF 137..216 CDD:240923 42/78 (54%)
U2B''NP_180585.1 RRM1_U1A_like 12..88 CDD:240692 52/75 (69%)
RRM2_U1A_like 156..228 CDD:240693 38/71 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 111 1.000 Domainoid score I2079
eggNOG 1 0.900 - - E1_KOG4206
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 237 1.000 Inparanoid score I1103
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm2910
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - O PTHR10501
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.