DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment snf and Rnpc3

DIOPT Version :9

Sequence 1:	NP_511045.1	Gene:	snf / 31442	FlyBaseID:	FBgn0003449	Length:	216	Species:	Drosophila melanogaster
Sequence 2:	NP_001033785.1	Gene:	Rnpc3 / 67225	MGIID:	1914475	Length:	514	Species:	Mus musculus

Alignment Length:	122	Identity:	36/122 - (29%)
Similarity:	58/122 - (47%)	Gaps:	27/122 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 PNQTIYINNLNEKIKKEELK--KSLYAIFSQFGQ--ILDIVALKTLKMRGQAFVIFKEIGSASNA 65
            ||..||:.||...:::::||  ...|..||...|  :.||..:|..:|:|||||......:|:.|
Mouse   416 PNCRIYVKNLARHVQEKDLKFIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFVGLPNEKAAAKA 480

  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKK 122
            |:...|:..:.|||.:.:::|             .|||:          |.|:.|:|
Mouse   481 LKEANGYVLFGKPMVVQFARS-------------ARPKQ----------DSKEGKRK 514

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
snf	NP_511045.1	RRM	<5..177	CDD:223796	36/122 (30%)
		RRM_SF	6..96	CDD:302621	28/93 (30%)
		RRM2_SNF	137..216	CDD:240923
Rnpc3	NP_001033785.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..26
		RRM	<26..>105	CDD:223796
		RRM1_RBM40_like	28..100	CDD:240684
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	106..133
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	213..282
		RRM	311..>509	CDD:223796	33/115 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	337..363
		RRM2_RBM40_like	417..499	CDD:240685	27/81 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4206
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900