DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and rnpc3

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001035019.1 Gene:rnpc3 / 565672 ZFINID:ZDB-GENE-060312-35 Length:505 Species:Danio rerio


Alignment Length:123 Identity:30/123 - (24%)
Similarity:56/123 - (45%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PNQTIYINNLNEKIKKEELKKSLYAIFSQFG-----QILDIVALKTLKMRGQAFVIFKEIGSASN 64
            |...:|:.|:.:.:::::| |.:|..:....     .:.|||.:|..:|:||||:......||..
Zfish   403 PTCRLYVKNVAKHVEEKDL-KFIYGRYIDISSEEERNMFDIVLMKEGRMKGQAFIGLPSERSAQK 466

  Fly    65 ALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKK 122
            ||:...|:...|||:.:.:::|             .:||:       ...|.||..:|
Zfish   467 ALKETNGYVLKDKPLVVQFARS-------------AKPKQ-------ESADPKKGGRK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 30/123 (24%)
RRM_SF 6..96 CDD:302621 23/94 (24%)
RRM2_SNF 137..216 CDD:240923
rnpc3NP_001035019.1 RRM <1..>141 CDD:223796
RRM1_RBM40_like 16..88 CDD:240684
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..123
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..236
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..374
RRM <371..>495 CDD:223796 26/112 (23%)
RRM2_RBM40_like 404..486 CDD:240685 22/82 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..505 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.