DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and RNPC3

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_060089.1 Gene:RNPC3 / 55599 HGNCID:18666 Length:517 Species:Homo sapiens


Alignment Length:122 Identity:35/122 - (28%)
Similarity:59/122 - (48%) Gaps:27/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PNQTIYINNLNEKIKKEELKK--SLYAIFSQFGQ--ILDIVALKTLKMRGQAFVIFKEIGSASNA 65
            ||..||:.||.:.:::::||.  ..|..||...|  :.||..:|..:|:||||:......:|:.|
Human   418 PNCRIYVKNLAKHVQEKDLKYIFGRYVDFSSETQRIMFDIRLMKEGRMKGQAFIGLPNEKAAAKA 482

  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKK 122
            |:...|:..:.|||.:.:::|             .|||:          |.|:.|:|
Human   483 LKEANGYVLFGKPMVVQFARS-------------ARPKQ----------DPKEGKRK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 35/122 (29%)
RRM_SF 6..96 CDD:302621 27/93 (29%)
RRM2_SNF 137..216 CDD:240923
RNPC3NP_060089.1 Necessary for interaction with PDCD7. /evidence=ECO:0000269|PubMed:16096647 1..257
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
RRM1_RBM40_like 28..100 CDD:409684
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 106..130
Necessary for binding to m(7)G-capped U12 snRNA 211..380
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..254
RRM 333..>515 CDD:223796 33/119 (28%)
RRM2_RBM40_like 419..501 CDD:409685 26/81 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.