DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and snrpa

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001016784.1 Gene:snrpa / 549538 XenbaseID:XB-GENE-494246 Length:282 Species:Xenopus tropicalis


Alignment Length:278 Identity:153/278 - (55%)
Similarity:180/278 - (64%) Gaps:63/278 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNAL 66
            |:.||.|||||||||||||:|||||||||||||||||||:..::||||||||||||||.||:|||
 Frog     5 EVRPNNTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEISSATNAL 69

  Fly    67 RTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSA---- 127
            |:|||||||||||:|.||||||||:||:|||:.||.:|.:..:...|.:....||..|.:|    
 Frog    70 RSMQGFPFYDKPMRIQYSKSDSDIIAKMKGTYVERDRKRQEKRKVKGQEAPGVKKALPGAALLPG 134

  Fly   128 -----------------------------------------------ENSNPNAQ---------- 135
                                                           ....|:..          
 Frog   135 VPGQMAGMQNIPGMTQAPRMMHMAGQAPYMHHPGMMPPPGMAPGQIPPGGMPHGHLMPGQMAPMQ 199

  Fly   136 --TEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEAL 198
              :|.|||.|||||||||||||:|||||||||||||||||||.|||||||||..|:|:.||:|:|
 Frog   200 PISENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARESL 264

  Fly   199 QGFKITPTHAMKITFAKK 216
            ||||||.:::|||:||||
 Frog   265 QGFKITQSNSMKISFAKK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 124/234 (53%)
RRM_SF 6..96 CDD:302621 75/89 (84%)
RRM2_SNF 137..216 CDD:240923 62/78 (79%)
snrpaNP_001016784.1 RRM1_U1A 7..95 CDD:240921 74/87 (85%)
PABP-1234 <10..205 CDD:130689 87/194 (45%)
RRM2_U1A 203..282 CDD:240924 62/78 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5282
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3380
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm49059
Panther 1 1.100 - - LDO PTHR10501
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.030

Return to query results.
Submit another query.