DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and snrpb2

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001243119.1 Gene:snrpb2 / 402896 ZFINID:ZDB-GENE-060616-2 Length:220 Species:Danio rerio


Alignment Length:221 Identity:143/221 - (64%)
Similarity:179/221 - (80%) Gaps:6/221 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNA 65
            |::.||.||||||:|:||||||||:||||:|||||||:|||||||::|||||||||||:.:|:||
Zfish     1 MDIRPNHTIYINNVNDKIKKEELKRSLYALFSQFGQIMDIVALKTMRMRGQAFVIFKELSAATNA 65

  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENS 130
            ||.:||||||:|||:|.|:|:|||:|:|::||:.::.||.:..|.|. .....:..|||:.|.|:
Zfish    66 LRQLQGFPFYNKPMRIQYAKTDSDLVSKMRGTYGDKEKKKEKKKKAQ-EQAAANANKKPAGAVNT 129

  Fly   131 NPNAQT-----EQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQ 190
            .|....     :.|||.||||.||||||||||||||||||||||||||||.:|||:||||.:|.|
Zfish   130 QPPPPATVQIPDNPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGKHDISFVEFESEAQ 194

  Fly   191 SNAAKEALQGFKITPTHAMKITFAKK 216
            :..||:|||||:||.|.|||||:|||
Zfish   195 AGVAKDALQGFRITATCAMKITYAKK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 115/176 (65%)
RRM_SF 6..96 CDD:302621 67/89 (75%)
RRM2_SNF 137..216 CDD:240923 60/78 (77%)
snrpb2NP_001243119.1 RRM <1..>85 CDD:223796 63/83 (76%)
RRM1_U2B 6..96 CDD:240922 67/89 (75%)
RRM_SF 141..220 CDD:302621 60/78 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 286 1.000 Inparanoid score I2823
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - oto38702
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - O PTHR10501
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.