DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and sm

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001246428.1 Gene:sm / 37254 FlyBaseID:FBgn0003435 Length:552 Species:Drosophila melanogaster


Alignment Length:178 Identity:43/178 - (24%)
Similarity:69/178 - (38%) Gaps:33/178 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPF-YDKPMQIAYSKSD--S 88
            |:.:...:|.:..|..|||  ..|.|.|...:..:....::.:...|. ....:|||:||.:  |
  Fly   335 LFNLVCLYGNVARIKFLKT--KEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLS 397

  Fly    89 DIVAKI-----KGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTN 148
            :::...     ..:|||.            |..|.::...|:.|..:.     .|||::||...|
  Fly   398 EVINPFLLPDHSPSFKEY------------TGSKNNRFLSPAQASKNR-----IQPPSKILHFFN 445

  Fly   149 LPEETNEMMLSMLFN--QFPGFKEVRLVP---NRHDIAFVEFTTELQS 191
            .|....|..|..:||  ..|. ..|||.|   .|.....:||:...|:
  Fly   446 TPPGLTEDQLIGIFNIKDVPA-TSVRLFPLKTERSSSGLIEFSNISQA 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 39/162 (24%)
RRM_SF 6..96 CDD:302621 16/76 (21%)
RRM2_SNF 137..216 CDD:240923 20/60 (33%)
smNP_001246428.1 RRM2_hnRNPL_like 80..165 CDD:241138
RRM3_hnRNPL_like 319..390 CDD:240870 12/56 (21%)
RRM4_hnRNPL_like 437..519 CDD:240873 18/57 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10501
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.