DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and Snrpb2

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_038961397.1 Gene:Snrpb2 / 362223 RGDID:1310194 Length:243 Species:Rattus norvegicus


Alignment Length:225 Identity:151/225 - (67%)
Similarity:183/225 - (81%) Gaps:9/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNA 65
            |::.||.||||||:|:||||||||:||||:|||||.::|||||||:||||||||||||:||::||
  Rat    19 MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNA 83

  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTF-----KERPKKVKPPKPAPGTDEKKDKKKKPS 125
            ||.:||||||.|||:|.|:|:||||::|::|||     |:..||.|..:.|.....||..:..|:
  Rat    84 LRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTMEQAAAAANKKPGQGTPN 148

  Fly   126 SAE---NSNPNAQT-EQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFT 186
            ||.   |:.||.|. :.|||.||||.||||||||||||||||||||||||||||.|||||||||.
  Rat   149 SANTQGNAAPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFE 213

  Fly   187 TELQSNAAKEALQGFKITPTHAMKITFAKK 216
            .:.|:.||::|||||||||:||||||:|||
  Rat   214 NDGQAGAARDALQGFKITPSHAMKITYAKK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 120/180 (67%)
RRM_SF 6..96 CDD:302621 67/89 (75%)
RRM2_SNF 137..216 CDD:240923 63/78 (81%)
Snrpb2XP_038961397.1 RRM1_U2B 24..114 CDD:409907 67/89 (75%)
RRM2_U2B 164..243 CDD:240925 63/78 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341042
Domainoid 1 1.000 108 1.000 Domainoid score I6311
eggNOG 1 0.900 - - E1_KOG4206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 297 1.000 Inparanoid score I2635
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm45975
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - O PTHR10501
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.