DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and snrpa

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_955965.1 Gene:snrpa / 324121 ZFINID:ZDB-GENE-030131-2841 Length:281 Species:Danio rerio


Alignment Length:277 Identity:158/277 - (57%)
Similarity:177/277 - (63%) Gaps:62/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNAL 66
            ||..|.|||||||||||||:|||||||||||||||||||:..:||||:||||||||||.||||||
Zfish     5 EMRLNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRTLKMKGQAFVIFKEINSASNAL 69

  Fly    67 RTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPK---KVKPPKPAPGTDEKKDKKKKPSSA- 127
            |:|||||||||||:|.|||.||||:||:||||.||.:   |.||..|..|..:|......|:.| 
Zfish    70 RSMQGFPFYDKPMRIQYSKQDSDIIAKMKGTFVERDRKKEKKKPKVPEAGAGKKGGSGATPAMAG 134

  Fly   128 ----------------------------------------------------------ENSNPNA 134
                                                                      ....|..
Zfish   135 VPAAIPGMPPMSQAPRMMPMPGQPPYMPPPGMMPPPNMAPGQMPPGAMPPGGMMPGQMPGQMPQQ 199

  Fly   135 QTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQ 199
            .:|.|||.|||||||||||||:|||||||||||||||||||.|||||||||..|:|:.||:||||
Zfish   200 VSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAAREALQ 264

  Fly   200 GFKITPTHAMKITFAKK 216
            |||||.::||||:||||
Zfish   265 GFKITQSNAMKISFAKK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 126/233 (54%)
RRM_SF 6..96 CDD:302621 75/89 (84%)
RRM2_SNF 137..216 CDD:240923 64/78 (82%)
snrpaNP_955965.1 RRM1_U1A 7..95 CDD:240921 73/87 (84%)
RRM <9..>98 CDD:223796 75/88 (85%)
RRM <199..>268 CDD:223796 55/68 (81%)
RRM2_U1A 202..281 CDD:240924 64/78 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580940
Domainoid 1 1.000 129 1.000 Domainoid score I5249
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3380
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - LDO PTHR10501
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1270
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.