DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and msl1

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_595571.1 Gene:msl1 / 2541219 PomBaseID:SPBC8D2.09c Length:111 Species:Schizosaccharomyces pombe


Alignment Length:90 Identity:44/90 - (48%)
Similarity:67/90 - (74%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NQ-TIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTM 69
            || |:|:||||:||.|.:|:.:||.:||.:|.::|||||||.||||||.|:|.:..:|:.|::.:
pombe     2 NQNTLYVNNLNDKINKNDLRTALYMLFSTYGTVVDIVALKTPKMRGQAHVVFFDPSAAAIAMKAL 66

  Fly    70 QGFPFYDKPMQIAYSKSDSDIVAKI 94
            :.|.|:.|.|:|.|:.|.|.|:.:|
pombe    67 KNFIFFGKEMKIQYAHSKSKIIERI 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 44/90 (49%)
RRM_SF 6..96 CDD:302621 44/90 (49%)
RRM2_SNF 137..216 CDD:240923
msl1NP_595571.1 RRM <1..>86 CDD:223796 41/83 (49%)
RRM1_U1A_like 5..82 CDD:240692 38/76 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I2358
eggNOG 1 0.900 - - E1_KOG4206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100753
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1270
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.