DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and Snrpb2

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_067310.1 Gene:Snrpb2 / 20639 MGIID:104805 Length:225 Species:Mus musculus


Alignment Length:225 Identity:149/225 - (66%)
Similarity:181/225 - (80%) Gaps:9/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNA 65
            |::.||.||||||:|:||||||||:||||:|||||.::|||||||:||||||||||||:||::||
Mouse     1 MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNA 65

  Fly    66 LRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTF-----KERPKKVKPPKPAPGTDEKKDKKKKPS 125
            ||.:||||||.|||:|.|:|:||||::|::|||     |:..||.|..:.|.....||..:..|:
Mouse    66 LRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTMEQAAAAANKKPGQGTPN 130

  Fly   126 SAENSN---PNAQT-EQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFT 186
            :|....   ||.|. :.|||.||||.||||||||||||||||||||||||||||.|||||||||.
Mouse   131 AANTQGTAAPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFE 195

  Fly   187 TELQSNAAKEALQGFKITPTHAMKITFAKK 216
            .:.|:.||::|||||||||:||||||:|||
Mouse   196 NDGQAGAARDALQGFKITPSHAMKITYAKK 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 118/180 (66%)
RRM_SF 6..96 CDD:302621 67/89 (75%)
RRM2_SNF 137..216 CDD:240923 63/78 (81%)
Snrpb2NP_067310.1 RRM1_U2B 6..96 CDD:240922 67/89 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..144 11/43 (26%)
RRM2_U2B 146..225 CDD:240925 63/78 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837323
Domainoid 1 1.000 108 1.000 Domainoid score I6451
eggNOG 1 0.900 - - E1_KOG4206
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2728
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54412
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm43887
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - O PTHR10501
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1270
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.