DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and rnp-3

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_500505.1 Gene:rnp-3 / 177182 WormBaseID:WBGene00004386 Length:217 Species:Caenorhabditis elegans


Alignment Length:214 Identity:104/214 - (48%)
Similarity:148/214 - (69%) Gaps:4/214 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTM 69
            ||.|||:||||||:||:|||:||:.:|:|||:|:.:::.:..||||||.::|||:.|||||||.:
 Worm     6 PNHTIYVNNLNEKVKKDELKRSLHMVFTQFGEIIQLMSFRKEKMRGQAHIVFKEVSSASNALRAL 70

  Fly    70 QGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNA 134
            ||||||.|||:|.|::.|||::::.||||.|  |:.|..|.|....||..|..|.::........
 Worm    71 QGFPFYGKPMRIQYAREDSDVISRAKGTFVE--KRQKSTKIAKKPYEKPAKNGKSAAEPTQKEPQ 133

  Fly   135 QTEQP--PNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEA 197
            :|:.|  ||.|||.:|:||.|....:..:|:||||.:|||.:||..|.||:|:.:|..|..|::|
 Worm   134 ETDGPGLPNNILFCSNIPEGTEPEQIQTIFSQFPGLREVRWMPNTKDFAFIEYESEDLSEPARQA 198

  Fly   198 LQGFKITPTHAMKITFAKK 216
            |..|:||||..:.:.||.|
 Worm   199 LDNFRITPTQQITVKFASK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 86/173 (50%)
RRM_SF 6..96 CDD:302621 52/89 (58%)
RRM2_SNF 137..216 CDD:240923 36/80 (45%)
rnp-3NP_500505.1 RRM <6..177 CDD:223796 85/172 (49%)
RRM1_U1A_like 9..86 CDD:240692 48/76 (63%)
RRM2_U1A_like 141..212 CDD:240693 33/70 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159497
Domainoid 1 1.000 106 1.000 Domainoid score I4156
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I2340
Isobase 1 0.950 - 0.928771 Normalized mean entropy S1235
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm14394
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - LDO PTHR10501
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.820

Return to query results.
Submit another query.