DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment snf and rnp-2

DIOPT Version :9

Sequence 1:NP_511045.1 Gene:snf / 31442 FlyBaseID:FBgn0003449 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_500504.1 Gene:rnp-2 / 177181 WormBaseID:WBGene00004385 Length:206 Species:Caenorhabditis elegans


Alignment Length:216 Identity:108/216 - (50%)
Similarity:144/216 - (66%) Gaps:13/216 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNAL 66
            |:.||.|:||||||||||.:||:|||.|:|.|||:|:.::..:||||||||.|||||:.:||.|.
 Worm     3 EVAPNSTLYINNLNEKIKIDELRKSLVAVFKQFGEIVSVMCFRTLKMRGQAHVIFKELPAASAAR 67

  Fly    67 RTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTF-KERPKKVKPPKPAPGTDEKKDKKKKPSSAENS 130
            ..:.|||||:|||:|.:::.|||:||:.|||: |..||.:         .||..||.|....||.
 Worm    68 EALNGFPFYEKPMRIQFAREDSDVVAQEKGTYIKREPKYL---------SEKILKKPKSRKKENG 123

  Fly   131 NPNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAK 195
            ...   ..|||:|||.||||:.....||.::||||.|.|::|:||||..||||||.|:..:..|:
 Worm   124 GDG---PAPPNKILFCTNLPDSATAEMLEIMFNQFAGLKDIRMVPNRPGIAFVEFDTDSLAIPAR 185

  Fly   196 EALQGFKITPTHAMKITFAKK 216
            ..|..|||:..|.|::.:|||
 Worm   186 TTLNNFKISAEHTMRVDYAKK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snfNP_511045.1 RRM <5..177 CDD:223796 88/172 (51%)
RRM_SF 6..96 CDD:302621 53/89 (60%)
RRM2_SNF 137..216 CDD:240923 38/78 (49%)
rnp-2NP_500504.1 RRM <6..206 CDD:223796 105/211 (50%)
RRM1_U1A_like 9..86 CDD:240692 47/76 (62%)
RRM2_U1A_like 130..201 CDD:240693 36/70 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159498
Domainoid 1 1.000 66 1.000 Domainoid score I6582
eggNOG 1 0.900 - - E1_KOG4206
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3380
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54412
OrthoDB 1 1.010 - - D1608132at2759
OrthoFinder 1 1.000 - - FOG0001375
OrthoInspector 1 1.000 - - otm14394
orthoMCL 1 0.900 - - OOG6_100753
Panther 1 1.100 - - O PTHR10501
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1270
SonicParanoid 1 1.000 - - X1105
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.750

Return to query results.
Submit another query.