DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and MPK16

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_197402.1 Gene:MPK16 / 832019 AraportID:AT5G19010 Length:567 Species:Arabidopsis thaliana


Alignment Length:300 Identity:103/300 - (34%)
Similarity:162/300 - (54%) Gaps:22/300 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTA--LREIKILQELQHEN 73
            ||.....:|:|.:..|..|.||.|.:.||:|||     .|..:.::...  |||||:|:.|:|.:
plant    24 RYRIEEVIGKGSYGVVCSAYDTHTGEKVAIKKI-----NDIFEHVSDATRILREIKLLRLLRHPD 83

  Fly    74 IIGLVDVF-----GQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWI 133
            |:.:..:.     .:..::.:||:.|::||..:||.|. .||..:.:.:....|:||:|:|...:
plant    84 IVEIKHILLPPSRREFRDIYVVFELMESDLHQVIKAND-DLTPEHYQFFLYQLLRGLKYIHTANV 147

  Fly   134 LHRDLKPNNLLVNSDGILKIGDFGLAK-SFG-SPNRIY-THHVVTRWYRSPELLFGA--RQYGTG 193
            .||||||.|:|.|:|..|||.|||||: :|. :|..|: |.:|.|||||:|||. |:  .:|...
plant   148 FHRDLKPKNILANADCKLKICDFGLARVAFNDTPTAIFWTDYVATRWYRAPELC-GSFFSKYTPA 211

  Fly   194 VDMWAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHL--SKLHDYL-QFRNFPGT 255
            :|:|::|||.|||:...|..||.:.:.||..:...||||:......:  .|...|| ..|.....
plant   212 IDIWSIGCIFAELLTGKPLFPGKNVVHQLDLMTDMLGTPSAEAIGRVRNEKARRYLSSMRKKKPI 276

  Fly   256 PLDNIFTAAGNDLIHLMQRLFAMNPLRRVSCREALSMPYF 295
            |..:.|.......:.|::::.:..|..|.:..|||:..||
plant   277 PFSHKFPHTDPLALRLLEKMLSFEPKDRPTAEEALADVYF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 102/299 (34%)
STKc_CDK7 11..308 CDD:270833 102/299 (34%)
MPK16NP_197402.1 STKc_TDY_MAPK 24..361 CDD:143364 102/299 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.