DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and cdk7

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001017219.1 Gene:cdk7 / 549973 XenbaseID:XB-GENE-485507 Length:352 Species:Xenopus tropicalis


Alignment Length:354 Identity:232/354 - (65%)
Similarity:278/354 - (78%) Gaps:15/354 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NANDKTERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQE 68
            :...::::|.||.|||||||||||||||..|::|||:||||.|.|.:|:||||||||||||:|||
 Frog    10 DVRSRSKQYEKLEFLGEGQFATVYKARDKNTDRIVAIKKIKLGHRAEAKDGINRTALREIKLLQE 74

  Fly    69 LQHENIIGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWI 133
            |.|.|||||:|.||..||:|||||||:|||||||||..::||.|:||:|.:|||:||||||..||
 Frog    75 LSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDTSLVLTPAHIKSYMLMTLQGLEYLHHLWI 139

  Fly   134 LHRDLKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWA 198
            |||||||||||::.:|:||:.|||||||||||||||||.||||||||||||||||.||.||||||
 Frog   140 LHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRIYTHQVVTRWYRSPELLFGARMYGVGVDMWA 204

  Fly   199 VGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYLQFRNFPGTPLDNIFTA 263
            ||||||||:|||||:|||||||||||||.|||||||.:||.:|.|.||:.|::||||||.:||.|
 Frog   205 VGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPGMSSLPDYVAFKSFPGTPLHHIFIA 269

  Fly   264 AGNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKPAPTVGPKLPMPS-AILAAKEGANPQTGDT 327
            ||:||:.|:|.||..||..|.:..:||...||:|:||||.|..||.|: ::.|.||..|...|  
 Frog   270 AGDDLLELLQGLFTFNPCARCTASQALRKRYFSNRPAPTPGSLLPRPNCSVEALKEQQNLNLG-- 332

  Fly   328 KPALKRKLVETTVRGNGLAQK---KRLQF 353
               :|||      |..|:.||   |:|.|
 Frog   333 ---IKRK------RTEGMDQKDIAKKLNF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 214/301 (71%)
STKc_CDK7 11..308 CDD:270833 214/296 (72%)
cdk7NP_001017219.1 STKc_CDK7 17..314 CDD:270833 214/296 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 434 1.000 Domainoid score I573
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1363
Inparanoid 1 1.050 459 1.000 Inparanoid score I1530
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1367115at2759
OrthoFinder 1 1.000 - - FOG0003675
OrthoInspector 1 1.000 - - oto102528
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R249
SonicParanoid 1 1.000 - - X2548
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.