DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and cdk2

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_998571.1 Gene:cdk2 / 406715 ZFINID:ZDB-GENE-040426-2741 Length:298 Species:Danio rerio


Alignment Length:294 Identity:120/294 - (40%)
Similarity:182/294 - (61%) Gaps:5/294 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENI 74
            |.:.|:..:|||.:..||||::.||.:.||:|||:   .:...:|:..||:|||.:|:||.|.||
Zfish     2 ESFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIR---LDTETEGVPSTAIREISLLKELNHPNI 63

  Fly    75 IGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKII-LTQANIKAYAIMTLKGLEYLHLNWILHRDL 138
            :.|.||....:.:.|||:|:..||:..:....:. ::...:|:|....|:||.:.|.:.:|||||
Zfish    64 VKLRDVIHTENKLYLVFEFLHQDLKRFMDSTSVSGISLPLVKSYLFQLLQGLAFCHSHRVLHRDL 128

  Fly   139 KPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCIL 203
            ||.|||:|:.|.:|:.|||||::||.|.|.|||.|||.|||:||:|.|.:.|.|.||:|::|||.
Zfish   129 KPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIF 193

  Fly   204 AELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYL-QFRNFPGTPLDNIFTAAGND 267
            ||::.|....||||::|||.|||.|||||.|:.||.::.:.||. .|..:....|..:......|
Zfish   194 AEMITRRALFPGDSEIDQLFRIFRTLGTPDESIWPGVTSMPDYKPSFPKWARQDLSKVVPPLDED 258

  Fly   268 LIHLMQRLFAMNPLRRVSCREALSMPYFANKPAP 301
            ...|:.::...:|.:|:|.:.||...:|.:...|
Zfish   259 GRDLLGQMLTYDPNKRISAKNALVHRFFRDVTMP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 120/294 (41%)
STKc_CDK7 11..308 CDD:270833 119/293 (41%)
cdk2NP_998571.1 PLN00009 1..291 CDD:177649 119/291 (41%)
STKc_CDK2_3 3..286 CDD:270844 117/285 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.