DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and cdk1

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_988908.1 Gene:cdk1 / 394503 XenbaseID:XB-GENE-482750 Length:302 Species:Xenopus tropicalis


Alignment Length:292 Identity:126/292 - (43%)
Similarity:182/292 - (62%) Gaps:12/292 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENI 74
            :.|.|:..:|||.:..|||.|...|.|:||:|||:   .|:..:|:..||:|||.:|:||||.||
 Frog     2 DEYTKIEKIGEGTYGVVYKGRHKATGQVVAMKKIR---LENEEEGVPSTAIREISLLKELQHPNI 63

  Fly    75 IGLVDVFGQLSNVSLVFDFMDTDLEVI---IKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHR 136
            :.|:||..|.|.:.|:|:|:..||:..   |...:.|.|.. :|:|....|:|:.:.|...:|||
 Frog    64 VCLLDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQYIDTML-VKSYLYQILQGIVFCHSRRVLHR 127

  Fly   137 DLKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGC 201
            ||||.|||::|.|::|:.|||||::||.|.|:|||.|||.|||:||:|.|:.:|.|.||:|::|.
 Frog   128 DLKPQNLLIDSKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRAPEVLLGSVRYSTPVDVWSIGT 192

  Fly   202 ILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYLQFRNFPGTPLDNIFTAAGN 266
            |.||:..:.|...|||::|||.|||..||||....||.:..|.||.  ..||.....|:.....|
 Frog   193 IFAEIATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYK--NTFPKWKGGNLSANVKN 255

  Fly   267 ---DLIHLMQRLFAMNPLRRVSCREALSMPYF 295
               |.:.|:.::...:|.:|:|.|:||..|||
 Frog   256 IDKDGLDLLSKMLIYDPAKRISARKALLHPYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 126/292 (43%)
STKc_CDK7 11..308 CDD:270833 126/291 (43%)
cdk1NP_988908.1 STKc_CDK1_euk 3..287 CDD:270845 124/289 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.