DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and Cdk8

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster


Alignment Length:337 Identity:116/337 - (34%)
Similarity:179/337 - (53%) Gaps:53/337 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGEGQFATVYKA--RDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENIIGLVDV 80
            :|.|.:..||||  ::|...:..|:|:| .|:      |::.:|.|||.:|:||:|:|:|.|:.|
  Fly    27 VGRGTYGHVYKAKWKETSDGKEYALKQI-DGT------GLSMSACREIALLRELKHQNVITLIRV 84

  Fly    81 FGQLSN----VSLVFDFMDTDLEVIIK--------DNKIILTQANIKAYAIMTLKGLEYLHLNWI 133
            |  ||:    |.|:.|:.:.||..|||        ..::::.:..:|:.....|.|:.|||.||:
  Fly    85 F--LSHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMVKSLLYQILDGIHYLHSNWV 147

  Fly   134 LHRDLKPNNLLV----NSDGILKIGDFGLAKSFGSPNRIYTH---HVVTRWYRSPELLFGARQYG 191
            |||||||.|:||    |..|.:||.|.|.|:.|.:|.:....   .|||.|||:||||.|||.|.
  Fly   148 LHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYT 212

  Fly   192 TGVDMWAVGCILAELMLRVP-FMPGDSDL--------DQLTRIFSTLGTPTEAEWPHLSKLHDYL 247
            ..:|:||:|||.|||:...| |.....|:        |||.|||:.:|.|.:.:|..:.|:.::.
  Fly   213 KAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMPEHH 277

  Fly   248 QF-RNFPGTPLDNIFTA---------AGNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKPAPT 302
            .. ::|..:.......|         ..:...||:|:|..|:|.:|::..:|:...||..:|.||
  Fly   278 TLTKDFKRSTYSTCSLAKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDQYFQEEPQPT 342

  Fly   303 ----VGPKLPMP 310
                .|..:|.|
  Fly   343 QDVFAGCPIPYP 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 114/333 (34%)
STKc_CDK7 11..308 CDD:270833 114/333 (34%)
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 108/316 (34%)
S_TKc 22..335 CDD:214567 108/316 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.