DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and CG7028

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster


Alignment Length:337 Identity:88/337 - (26%)
Similarity:149/337 - (44%) Gaps:65/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RYAKLSFLGEGQFATVYKARDTVTNQI-VAVKKIKKGSREDARDGINRTALREIKILQELQHE-- 72
            ||....:.|:|.|:.|.:.||....|. ||:|.|:.      .:.:::|.|||::||::|...  
  Fly   591 RYLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRN------NEIMHKTGLRELEILKKLNDADP 649

  Fly    73 ----NIIGLVDVFGQLSNVSLVFDFMDTDLEVIIK--DNKIILTQANIKAYAIMTLKGLEYLHLN 131
                :.:.|...|....::.:||:.:..:|..::|  ...:.|....:::|.......|:.|...
  Fly   650 EDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQQLFLALKLLKKT 714

  Fly   132 WILHRDLKPNNLLVNSDG-ILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVD 195
            .|||.|:||:|:|||.:. |||:.|||.|.:. |.|.| |.::|:|:|||||::.|. .|..|:|
  Fly   715 GILHADIKPDNILVNENNLILKLCDFGSASAI-SDNEI-TPYLVSRFYRSPEIILGI-PYDYGID 776

  Fly   196 MWAVGCILAELMLRVPFMPGDS---------------------------------------DLDQ 221
            .|:.||.:.||........|.|                                       ::|:
  Fly   777 TWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRKGQFREQHFDQSCNFLYHEIDK 841

  Fly   222 LTRIFSTLGTPTEAEWPHLSKLHDYLQFRNFPGTPLDNIFTAAGNDLIHLMQRLFAMNPLRRVSC 286
            ||.....:..|...  |..|...:.:..:|.|......:     ..|..|::.:||::|.:|:|.
  Fly   842 LTEREKIVVMPVVK--PSRSLQQELIADQNLPDDQHRKV-----TQLKDLLENMFALDPAKRISL 899

  Fly   287 REALSMPYFANK 298
            .:||..|:...|
  Fly   900 NQALVHPFIQEK 911

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 88/337 (26%)
STKc_CDK7 11..308 CDD:270833 88/337 (26%)
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 87/332 (26%)
S_TKc 599..908 CDD:214567 85/324 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.