DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk7 and Cdk4

DIOPT Version :9

Sequence 1:NP_511044.1 Gene:Cdk7 / 31441 FlyBaseID:FBgn0263237 Length:353 Species:Drosophila melanogaster
Sequence 2:NP_001286493.1 Gene:Cdk4 / 36854 FlyBaseID:FBgn0016131 Length:317 Species:Drosophila melanogaster


Alignment Length:309 Identity:115/309 - (37%)
Similarity:174/309 - (56%) Gaps:39/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQEL---QHEN 73
            |.:|:.:|||.:.|||:|||.:|..|||:||::....|   :|:..:.||||.:|::|   .|.|
  Fly    26 YQELNIIGEGAYGTVYRARDVITGNIVALKKVRISLNE---NGVPMSTLREISLLKQLNASNHAN 87

  Fly    74 IIGLVDVF------GQLSNVSLVFDFMDTDL-EVIIKDNKIILTQANIKAYAIMTLKGLEYLHLN 131
            |:.|.:|.      |||. :.|||:.::.|| ::|.:..|..::...|:..:...|.|:::||.:
  Fly    88 IVKLYEVCQFLERDGQLL-ILLVFEHVEQDLSDLIDRLPKSGMSPPTIQRLSRELLTGVDFLHSH 151

  Fly   132 WILHRDLKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDM 196
            .|:||||||.||||:|.|.|||.||||||::||..:: |..|||.|||:||:|. |:.|.:.||:
  Fly   152 RIIHRDLKPQNLLVSSQGHLKIADFGLAKTYGSEMKL-TSVVVTLWYRAPEVLL-AQPYNSTVDI 214

  Fly   197 WAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWP--------HLSKLHDYLQFRNFP 253
            |:..||:.|:..|....||.|:.:||.|||...|.|||.:||        |..:.|        |
  Fly   215 WSAACIIFEMFNRRALFPGTSEKNQLDRIFELTGRPTEQQWPQTISVALEHFPQRH--------P 271

  Fly   254 GTPLD---NIFTAAGNDLIHLMQRLFAMNPLRRVSCREALSMPYFANKP 299
            ..|.|   ::...|.:    |:.::.:.:...|.|....|...||..:|
  Fly   272 KRPKDFCPHLCKYADD----LLNKMLSYDLHLRPSALACLEHDYFQQEP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk7NP_511044.1 PTZ00024 6..308 CDD:240233 115/309 (37%)
STKc_CDK7 11..308 CDD:270833 115/309 (37%)
Cdk4NP_001286493.1 STKc_CDK4_6_like 26..312 CDD:270831 112/303 (37%)
S_TKc 26..312 CDD:214567 112/303 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442388
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.